Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRB2
LigandBDBM50036836
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37823
Ki 4580±n/a nM
Citation Macchia, BBalsamo, ABreschi, MCChiellini, GMacchia, MMartinelli, AMartini, CNardini, CNencetti, SRossello, A The [(methyloxy)imino]methyl moiety as a bioisoster of aryl. A novel class of completely aliphatic beta-adrenergic receptor antagonists. J Med Chem37:1518-25 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
ADRB2
Name:ADRB2
Synonyms:Beta-2 adrenoceptor | Beta-2 adrenoreceptor | adrenergic Beta
Type:Enzyme Catalytic Domain
Mol. Mass.:47141.18
Organism:BOVINE
Description:adrenergic Beta ADRB2 BOVINE::Q28044
Residue:418
Sequence:
MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE
AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD
NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND
RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036836
n/a
NameBDBM50036836
Synonyms:CHEMBL38114 | Propionaldehyde O-(2-hydroxy-3-isopropylamino-propyl)-oxime; compound with (E)-but-2-enedioic acid
TypeSmall organic molecule
Emp. Form.C9H20N2O2
Mol. Mass.188.2673
SMILESCC\C=N\OCC(O)CNC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: