Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReverse transcriptase
LigandBDBM50492111
Substrate/Competitorn/a
Meas. Tech.ChEMBL_969007
IC50 8300±n/a nM
Citation Masaoka, TChung, SCaboni, PRausch, JWWilson, JATaskent-Sezgin, HBeutler, JATocco, GLe Grice, SF Exploiting drug-resistant enzymes as tools to identify thienopyrimidinone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H. J Med Chem56:5436-45 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Reverse transcriptase
Name:Reverse transcriptase
Synonyms:n/a
Type:Protein
Mol. Mass.:29598.37
Organism:Human immunodeficiency virus 1
Description:Q9WKE8
Residue:254
Sequence:
PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50492111
NameBDBM50492111
Synonyms:CHEMBL2397290
TypeSmall organic molecule
Emp. Form.C13H11N3OS
Mol. Mass.257.311
SMILESCc1sc2nc([nH]c(=O)c2c1C)-c1cccnc1
Structure
n/a