Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50037123
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157870
Ki 270±n/a nM
Citation Thompson, SKMurthy, KHZhao, BWinborne, EGreen, DWFisher, SMDesJarlais, RLTomaszek, TAMeek, TDGleason, JG Rational design, synthesis, and crystallographic analysis of a hydroxyethylene-based HIV-1 protease inhibitor containing a heterocyclic P1'--P2' amide bond isostere. J Med Chem37:3100-7 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037123
NameBDBM50037123
Synonyms:CHEMBL108226 | {(1S,2S,4R)-1-Benzyl-4-[5-(2,2-dimethyl-but-3-enoyl)-1H-imidazol-2-yl]-2-hydroxy-5-phenyl-pentyl}-carbamic acid tert-butyl ester
TypeSmall organic molecule
Emp. Form.C32H41N3O4
Mol. Mass.531.6856
SMILESCC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@@H](O)C[C@@H](Cc1ccccc1)c1ncc([nH]1)C(=O)C(C)(C)C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a