Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50038212
Substrate/Competitorn/a
Meas. Tech.ChEMBL_139979
EC50 400±n/a nM
Citation Moltzen, EKPedersen, HBøgesø, KPMeier, EFrederiksen, KSánchez, CLøve Lembøl, H Bioisosteres of arecoline: 1,2,3,6-tetrahydro-5-pyridyl-substituted and 3-piperidyl-substituted derivatives of tetrazoles and 1,2,3-triazoles. Synthesis and muscarinic activity. J Med Chem37:4085-99 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038212
NameBDBM50038212
Synonyms:2-Ethyl-8-methyl-2,8-diaza-spiro[4.5]decane-1,3-dione | 2-Ethyl-8-methyl-2,8-diaza-spiro[4.5]decane-1,3-dione (RS-86) | 2-Ethyl-8-methyl-2,8-diaza-spiro[4.5]decane-1,3-dione(RS-86) | CHEMBL273308 | CHEMBL542883
TypeSmall organic molecule
Emp. Form.C11H18N2O2
Mol. Mass.210.2728
SMILESCCN1C(=O)CC2(CCN(C)CC2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a