Reaction Details |
 | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50489369 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_981453 |
---|
Ki | 5.9±n/a nM |
---|
Citation | Ghosh, AK; Parham, GL; Martyr, CD; Nyalapatla, PR; Osswald, HL; Agniswamy, J; Wang, YF; Amano, M; Weber, IT; Mitsuya, H Highly potent HIV-1 protease inhibitors with novel tricyclic P2 ligands: design, synthesis, and protein-ligand X-ray studies. J Med Chem56:6792-802 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50489369 |
---|
Name | BDBM50489369 |
Synonyms: | CHEMBL1232930 | GRL-0519 |
Type | Small organic molecule |
Emp. Form. | C30H40N2O9S |
Mol. Mass. | 604.712 |
SMILES | [H][C@@]12OCC[C@]1([H])[C@@]1([H])[C@H](CO[C@@]1([H])O2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
Structure |  |
n/a |
---|