Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50039531
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144466
IC50 20±n/a nM
Citation Neustadt, BRSmith, EMNechuta, TLBronnenkant, AAHaslanger, MFWatkins, RWFoster, CJSybertz, EJ Mercaptoacyl amino acid inhibitors of atriopeptidase. 1. Structure-activity relationship studies of methionine and S-alkylcysteine derivatives. J Med Chem37:2461-76 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CD10 antigen | CD_antigen=CD10 | Enkephalinase | NEP | Neutral Endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85570.75
Organism:Oryctolagus cuniculus (rabbit)
Description:NEP was purified to homogeneity from rabbit kidney.
Residue:750
Sequence:
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCVNETAIDSRGGQPLLKLLPDVYGWPVATQNWEQTYGT
SWSAEKSIAQLNSNYGKKVLINFFVGTDDKNSMNHIIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMIAVAKLIRQEEGLPIDENQISVEMNKVMELEKEIANATTKSEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLIKLKPILT
KYFPRDFQNLFSWRFIMDLVSSLSRTYKDSRNAFRKALYGTTSESATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWITGAA
IVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGIDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GSLQNSVEFSEAFQCPKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039531
NameBDBM50039531
Synonyms:(S)-2-((R)-2-Mercaptomethyl-3-phenyl-propionylamino)-3-(4-methyl-benzylsulfanyl)-propionic acid | CHEMBL310199
TypeSmall organic molecule
Emp. Form.C21H25NO3S2
Mol. Mass.403.558
SMILESCc1ccc(CSC[C@@H](NC(=O)[C@H](CS)Cc2ccccc2)C(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a