Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50039684
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29600
Kd 1.3±n/a nM
Citation Scammells, PJBaker, SPBelardinelli, LOlsson, RA Substituted 1,3-dipropylxanthines as irreversible antagonists of A1 adenosine receptors. J Med Chem37:2704-12 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039684
NameBDBM50039684
Synonyms:2-Bromo-N-(2,6-dioxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-acetamide | CHEMBL94284
TypeSmall organic molecule
Emp. Form.C13H18BrN5O3
Mol. Mass.372.218
SMILESCCCn1c2nc(NC(=O)CBr)[nH]c2c(=O)n(CCC)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a