Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50040076
Substrate/Competitorn/a
Meas. Tech.ChEMBL_216051
Ki 5.2±n/a nM
Citation Cecchetti, VFravolini, ASchiaffella, FTabarrini, OBruni, GSegre, G o-Chlorobenzenesulfonamidic derivatives of (aryloxy)propanolamines as beta-blocking/diuretic agents. J Med Chem36:157-61 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040076
NameBDBM50040076
Synonyms:4-Chloro-benzene-1,3-disulfonic acid 3-amide 1-({2-[2-hydroxy-3-(3-oxo-3,4-dihydro-2H-benzo[1,4]thiazin-8-yloxy)-propylamino]-ethyl}-amide) | CHEMBL289390
TypeSmall organic molecule
Emp. Form.C19H23ClN4O7S3
Mol. Mass.551.057
SMILESNS(=O)(=O)c1cc(ccc1Cl)S(=O)(=O)NCCNCC(O)COc1cccc2NC(=O)CSc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a