Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAICAR transformylase
LigandBDBM50041179
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28411
IC50>30000±n/a nM
Citation Gangjee, ADevraj, RMcGuire, JJKisliuk, RLQueener, SFBarrows, LR Classical and nonclassical furo[2,3-d]pyrimidines as novel antifolates: synthesis and biological activities. J Med Chem37:1169-76 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AICAR transformylase
Name:Thymidylate synthase/GAR transformylase/AICAR transformylase
Synonyms:5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase | 5-aminoimidazole-4-carboxamide-ribonucleotide transformylase | ATIC | Aminoimidazole carboxamide ribonucleotide transformylase (AICAR Tfase) | Bifunctional purine biosynthesis protein PURH | IMP cyclohydrolase | IMP synthetase | Inosinicase | Phosphoribosylaminoimidazolecarboxamide formyltransferase
Type:Protein
Mol. Mass.:64616.62
Organism:Homo sapiens (Human)
Description:P31939
Residue:592
Sequence:
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT
HTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL
CDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPIS
AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT
GVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDA
FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041179
NameBDBM50041179
Synonyms:2-{4-[(2,4-Diamino-furo[2,3-d]pyrimidin-5-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | CHEMBL17383
TypeSmall organic molecule
Emp. Form.C19H20N6O6
Mol. Mass.428.3987
SMILESNc1nc(N)c2c(CNc3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)coc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a