Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50041180
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54908
IC50>31000±n/a nM
Citation Gangjee, ADevraj, RMcGuire, JJKisliuk, RLQueener, SFBarrows, LR Classical and nonclassical furo[2,3-d]pyrimidines as novel antifolates: synthesis and biological activities. J Med Chem37:1169-76 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:18437.08
Organism:Lactobacillus casei
Description:ChEMBL_1357878
Residue:163
Sequence:
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041180
NameBDBM50041180
Synonyms:5-[(2,5-Dimethoxy-phenylamino)-methyl]-furo[2,3-d]pyrimidine-2,4-diamine | CHEMBL17044
TypeSmall organic molecule
Emp. Form.C15H17N5O3
Mol. Mass.315.3272
SMILESCOc1ccc(OC)c(NCc2coc3nc(N)nc(N)c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a