Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT1B
LigandBDBM50041688
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36637
IC50 1.3±n/a nM
Citation Mederski, WWDorsch, DBokel, HHBeier, NLues, ISchelling, P Non-peptide angiotensin II receptor antagonists: synthesis and biological activity of a series of novel 4,5-dihydro-4-oxo-3H-imidazo[4,5-c]pyridine derivatives. J Med Chem37:1632-45 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT1B
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041688
NameBDBM50041688
Synonyms:CHEMBL43500 | {2-Butyl-4-oxo-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3,4-dihydro-imidazo[4,5-c]pyridin-5-yl}-acetic acid methyl ester
TypeSmall organic molecule
Emp. Form.C27H27N7O3
Mol. Mass.497.5484
SMILESCCCCc1nc2ccn(CC(=O)OC)c(=O)c2n1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a