Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50044019
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30797
Ki 6.2±n/a nM
Citation Harriman, GCAbushanab, EStoeckler, JD Adenosine deaminase inhibitors. Synthesis and biological evaluation of 4-amino-1-(2(S)-hydroxy-3(R)-nonyl)-1H-imidazo[4,5-c]pyridine (3-deaza-(+)-EHNA) and certain C1' derivatives. J Med Chem37:305-8 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50044019
NameBDBM50044019
Synonyms:(2S,3R)-3-(4-Amino-imidazo[4,5-c]pyridin-1-yl)-nonan-2-ol | CHEMBL433164
TypeSmall organic molecule
Emp. Form.C15H24N4O
Mol. Mass.276.3773
SMILESCCCCCC[C@H]([C@H](C)O)n1cnc2c(N)nccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a