Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEBifunctional epoxide hydrolase 2
LigandBDBM50327846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1328394
IC50 0.400000±n/a nM
Citation Huang, SXCao, BMorisseau, CJin, YHammock, BDLong, YQ Structure-based optimization of the piperazino-containing 1,3-disubstituted ureas affording sub-nanomolar inhibitors of soluble epoxide hydrolase. Medchemcomm0:379-384 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EBifunctional epoxide hydrolase 2
Name:EBifunctional epoxide hydrolase 2
Synonyms:Cytosolic epoxide hydrolase 2 | Lipid-phosphate phosphatase | Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327846
NameBDBM50327846
Synonyms:1-(1-(Cyclopropanecarbonyl)piperidin-4-yl)-3-(4-(trifluoromethoxy)phenyl)urea | CHEMBL1257405 | US10383835, Compound 2214 | US9296693, 52
TypeSmall organic molecule
Emp. Form.C17H20F3N3O3
Mol. Mass.371.3542
SMILESFC(F)(F)Oc1ccc(NC(=O)NC2CCN(CC2)C(=O)C2CC2)cc1
Structure
n/a