Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50003473
Substrate/Competitorn/a
Meas. Tech.ChEBML_151691
IC50 10±n/a nM
Citation Carceller, EMerlos, MGiral, MAlmansa, CBartrolí, JGarcía-Rafanell, JForn, J Synthesis and structure-activity relationships of 1-acyl-4-((2-methyl-3-pyridyl)cyanomethyl)piperazines as PAF antagonists. J Med Chem36:2984-97 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003473
NameBDBM50003473
Synonyms:CHEMBL317193 | [4-(3,3-Diphenyl-acryloyl)-piperazin-1-yl]-pyridin-3-yl-acetonitrile
TypeSmall organic molecule
Emp. Form.C26H24N4O
Mol. Mass.408.495
SMILESO=[#6](\[#6]=[#6](/c1ccccc1)-c1ccccc1)-[#7]-1-[#6]-[#6]-[#7](-[#6]-[#6]-1)-[#6](C#N)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a