Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50047072
Substrate/Competitorn/a
Meas. Tech.ChEMBL_207650
Ki 13±n/a nM
Citation Nicolaï, EGoyard, JBenchetrit, TTeulon, JMCaussade, FVirone, ADelchambre, CCloarec, A Synthesis and structure-activity relationships of novel benzimidazole and imidazo[4,5-b]pyridine acid derivatives as thromboxane A2 receptor antagonists. J Med Chem36:1175-87 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50047072
NameBDBM50047072
Synonyms:4-[1-(4-Bromo-benzyl)-5-chloro-1H-benzoimidazol-2-yl]-3,3-dimethyl-butyric acid | CHEMBL18093
TypeSmall organic molecule
Emp. Form.C20H20BrClN2O2
Mol. Mass.435.742
SMILESCC(C)(CC(O)=O)Cc1nc2cc(Cl)ccc2n1Cc1ccc(Br)cc1
Structure
n/a