Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetType-1 angiotensin II receptor
LigandBDBM50003392
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36780
IC50 16±n/a nM
Citation Bradbury, RHAllott, CPDennis, MGirdwood, JAKenny, PWMajor, JSOldham, AARatcliffe, AHRivett, JERoberts, DA New nonpeptide angiotensin II receptor antagonists. 3. Synthesis, biological properties, and structure-activity relationships of 2-alkyl-4-(biphenylylmethoxy)pyridine derivatives. J Med Chem36:1245-54 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Type-1 angiotensin II receptor
Name:Type-1 angiotensin II receptor
Synonyms:AT1 | Angiotensin II type-1 receptor
Type:PROTEIN
Mol. Mass.:41004.19
Organism:Cavia porcellus
Description:ChEMBL_36783
Residue:359
Sequence:
MILNSSTEDGIKRIQDDCPKAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADICFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCVIIWLMAGLASLPAVIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFMFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKISDIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSTLSTKMSTLSYRPSDNVSSSAKKPVQCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003392
NameBDBM50003392
Synonyms:2-Methyl-4-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | 2-Methyl-4-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | CHEMBL142380
TypeSmall organic molecule
Emp. Form.C24H19N5O
Mol. Mass.393.4406
SMILESCc1cc(OCc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a