Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT1B
LigandBDBM50006909
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34820
IC50 37±n/a nM
Citation Ashton, WTCantone, CLChang, LLHutchins, SMStrelitz, RAMacCoss, MChang, RSLotti, VJFaust, KAChen, TB Nonpeptide angiotensin II antagonists derived from 4H-1,2,4-triazoles and 3H-imidazo[1,2-b][1,2,4]triazoles. J Med Chem36:591-609 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT1B
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006909
NameBDBM50006909
Synonyms:2-Butyl-5-chloro-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid | 2-Butyl-5-chloro-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid (EXP3174) | 2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid | 2-Butyl-5-chloro-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-imidazole-4-carboxylic acid (EXP3174) | CHEMBL907 | Carboxylic Acid Metabolite (E-3174) | E 3174 | EXP3174
TypeSmall organic molecule
Emp. Form.C22H21ClN6O2
Mol. Mass.436.894
SMILESCCCCc1nc(Cl)c(C(O)=O)n1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a