Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50051349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31838
Ki 60000±n/a nM
Citation Karton, YJiang, JLJi, XDMelman, NOlah, MEStiles, GLJacobson, KA Synthesis and biological activities of flavonoid derivatives as A3 adenosine receptor antagonists. J Med Chem39:2293-301 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051349
NameBDBM50051349
Synonyms:4-Methoxy-7-methyl-furo[3,2-g]chromen-5-one | CHEMBL45176
TypeSmall organic molecule
Emp. Form.C13H10O4
Mol. Mass.230.2161
SMILESCOc1c2ccoc2cc2oc(C)cc(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a