Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase, Soat
LigandBDBM50051461
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28798
IC50 5±n/a nM
Citation O'Brien, PMSliskovic, DRPicard, JALee, HTPurchase, CFRoth, BDWhite, ADAnderson, MMueller, SBBocan, TBousley, RHamelehle, KLHoman, RLee, PKrause, BRReindel, JFStanfield, RLTurluck, D Inhibitors of acyl-CoA:cholesterol O-acyltransferase. synthesis and pharmacological activity of (+/-)-2-dodecyl-alpha-phenyl-N-(2,4,6-trimethoxyphenyl)-2H-tetrazole-5- acetamide and structurally related tetrazole amide derivatives. J Med Chem39:2354-66 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase, Soat
Name:Sterol O-acyltransferase, Soat
Synonyms:ACAT-1 | Cholesterol acyltransferase 1
Type:PROTEIN
Mol. Mass.:64165.56
Organism:Rattus norvegicus
Description:ChEMBL_28796
Residue:545
Sequence:
MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLF
LKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISR
RSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVI
WTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLA
YTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPT
LIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLC
VFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVH
DWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMA
FNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWT
CRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051461
NameBDBM50051461
Synonyms:CHEMBL264861 | N-(2,6-Diisopropyl-phenyl)-2-(2-dodecyl-2H-tetrazol-5-yl)-acetamide
TypeSmall organic molecule
Emp. Form.C27H45N5O
Mol. Mass.455.6791
SMILESCCCCCCCCCCCCn1nnc(CC(=O)Nc2c(cccc2C(C)C)C(C)C)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a