Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50052033
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196914
Ki 4.6±n/a nM
Citation Zhang, LNadzan, AMHeyman, RALove, DLMais, DECroston, GLamph, WWBoehm, MF Discovery of novel retinoic acid receptor agonists having potent antiproliferative activity in cervical cancer cells. J Med Chem39:2659-63 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50052033
NameBDBM50052033
Synonyms:(2E,4E,6E)-7-(3,5-Di-tert-butyl-phenyl)-3-methyl-octa-2,4,6-trienoic acid | 7-(3,5-DITERT-BUTYLPHENYL)-3-METHYLOCTA-2,4,6-TRIENOIC ACID | CHEMBL89241
TypeSmall organic molecule
Emp. Form.C23H32O2
Mol. Mass.340.499
SMILESC\C(\C=C\C=C(/C)c1cc(cc(c1)C(C)(C)C)C(C)(C)C)=C/C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a