Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50052588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197383
EC50 40±n/a nM
Citation Canan Koch, SSDardashti, LJHebert, JJWhite, SKCroston, GEFlatten, KSHeyman, RANadzan, AM Identification of the first retinoid X, receptor homodimer antagonist. J Med Chem39:3229-34 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoic acid receptor alpha/Retinoid X receptor alpha
Synonyms:Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | Retinoic acid receptor alpha
Type:PROTEIN
Mol. Mass.:50778.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1466191
Residue:462
Sequence:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50052588
NameBDBM50052588
Synonyms:(2E,4E,6Z)-7-(3-Methoxy-5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-3-methyl-octa-2,4,6-trienoic acid | CHEMBL111589
TypeSmall organic molecule
Emp. Form.C24H32O3
Mol. Mass.368.5091
SMILESCOc1cc2c(cc1\C(C)=C/C=C/C(/C)=C/C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a