Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50054712
Substrate/Competitorn/a
Meas. Tech.ChEMBL_58195
IC50 7.6±n/a nM
Citation Norman, MHNavas, FThompson, JBRigdon, GC Synthesis and evaluation of heterocyclic carboxamides as potential antipsychotic agents. J Med Chem39:4692-703 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:D(2) dopamine receptor
Synonyms:DOPAMINE D2 | DRD2 | Dopamine D2 receptor | Dopamine Receptor D2
Type:Enzyme
Mol. Mass.:50957.64
Organism:Mus musculus (Mouse)
Description:P61168
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054712
n/a
NameBDBM50054712
Synonyms:3H-Benzoimidazole-4-carboxylic acid [4-(4-benzo[d]isothiazol-3-yl-piperazin-1-yl)-butyl]-amide | CHEMBL141319
TypeSmall organic molecule
Emp. Form.C23H26N6OS
Mol. Mass.434.557
SMILESO=C(NCCCCN1CCN(CC1)c1nsc2ccccc12)c1cccc2nc[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: