Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor
LigandBDBM50054708
Substrate/Competitorn/a
Meas. Tech.ChEMBL_58195
IC50 14±n/a nM
Citation Norman, MHNavas, FThompson, JBRigdon, GC Synthesis and evaluation of heterocyclic carboxamides as potential antipsychotic agents. J Med Chem39:4692-703 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor
Name:Dopamine receptor
Synonyms:D(2) dopamine receptor | DOPAMINE D2 | DRD2 | Dopamine Receptor D2 | Dopamine receptor | Dopamine2-like
Type:Enzyme
Mol. Mass.:50957.64
Organism:Mus musculus (Mouse)
Description:P61168
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054708
NameBDBM50054708
Synonyms:1H-Indole-3-carboxylic acid [4-(4-benzo[d]isothiazol-3-yl-piperazin-1-yl)-butyl]-amide | CHEMBL142456
TypeSmall organic molecule
Emp. Form.C24H27N5OS
Mol. Mass.433.569
SMILESO=C(NCCCCN1CCN(CC1)c1nsc2ccccc12)c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a