Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5HT1A)
LigandBDBM50054712
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1061
IC50 4.2±n/a nM
Citation Norman, MHNavas, FThompson, JBRigdon, GC Synthesis and evaluation of heterocyclic carboxamides as potential antipsychotic agents. J Med Chem39:4692-703 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5HT1A)
Name:Serotonin 1a (5-HT1a) receptor
Synonyms:5-HT1A | 5-hydroxytryptamine receptor 1A | Serotonin 1a (5-HT1a) receptor
Type:Enzyme
Mol. Mass.:46192.09
Organism:Mus musculus (Mouse)
Description:Q64264
Residue:421
Sequence:
MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGT
SFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGN
SKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054712
n/a
NameBDBM50054712
Synonyms:3H-Benzoimidazole-4-carboxylic acid [4-(4-benzo[d]isothiazol-3-yl-piperazin-1-yl)-butyl]-amide | CHEMBL141319
TypeSmall organic molecule
Emp. Form.C23H26N6OS
Mol. Mass.434.557
SMILESO=C(NCCCCN1CCN(CC1)c1nsc2ccccc12)c1cccc2nc[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: