Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2, membrane associated
LigandBDBM50055291
Substrate/Competitorn/a
Meas. Tech.ChEMBL_156219
IC50 69000±n/a nM
Citation Dillard, RDBach, NJDraheim, SEBerry, DRCarlson, DGChirgadze, NYClawson, DKHartley, LWJohnson, LMJones, NDMcKinney, ERMihelich, EDOlkowski, JLSchevitz, RWSmith, ACSnyder, DWSommers, CDWery, JP Indole inhibitors of human nonpancreatic secretory phospholipase A2. 2. Indole-3-acetamides with additional functionality. J Med Chem39:5137-58 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2, membrane associated
Name:Phospholipase A2 group IIA
Synonyms:GIIC sPLA2 | Group IIA phospholipase A2 | NPS-PLA2 | Non-Pancreatic Secretory Phospholipase A2 | Non-pancreatic secretory phospholipase A2 (hnps-PLA2) | Phosphatidylcholine 2-acylhydrolase
Type:Hydrolase
Mol. Mass.:16101.20
Organism:Homo sapiens (Human)
Description:The human nps PLA2 was cloned, and expressed in E. coli. There was a refolding process in the purification.
Residue:144
Sequence:
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055291
NameBDBM50055291
Synonyms:4-(1-Benzyl-3-carbamoylmethyl-2-methyl-1H-indol-5-yloxy)-butyric acid | CHEMBL356752
TypeSmall organic molecule
Emp. Form.C22H24N2O4
Mol. Mass.380.437
SMILESCc1c(CC(N)=O)c2cc(OCCCC(O)=O)ccc2n1Cc1ccccc1
Structure
n/a