Reaction Details |
 | Report a problem with these data |
Target | Phospholipase A2, membrane associated |
---|
Ligand | BDBM50055291 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_156219 |
---|
IC50 | 69000±n/a nM |
---|
Citation | Dillard, RD; Bach, NJ; Draheim, SE; Berry, DR; Carlson, DG; Chirgadze, NY; Clawson, DK; Hartley, LW; Johnson, LM; Jones, ND; McKinney, ER; Mihelich, ED; Olkowski, JL; Schevitz, RW; Smith, AC; Snyder, DW; Sommers, CD; Wery, JP Indole inhibitors of human nonpancreatic secretory phospholipase A2. 2. Indole-3-acetamides with additional functionality. J Med Chem39:5137-58 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Phospholipase A2, membrane associated |
---|
Name: | Phospholipase A2 group IIA |
Synonyms: | GIIC sPLA2 | Group IIA phospholipase A2 | NPS-PLA2 | Non-Pancreatic Secretory Phospholipase A2 | Non-pancreatic secretory phospholipase A2 (hnps-PLA2) | Phosphatidylcholine 2-acylhydrolase |
Type: | Hydrolase |
Mol. Mass.: | 16101.20 |
Organism: | Homo sapiens (Human) |
Description: | The human nps PLA2 was cloned, and expressed in E. coli. There was a refolding process in the purification. |
Residue: | 144 |
Sequence: | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
|
|
|
BDBM50055291 |
---|
Name | BDBM50055291 |
Synonyms: | 4-(1-Benzyl-3-carbamoylmethyl-2-methyl-1H-indol-5-yloxy)-butyric acid | CHEMBL356752 |
Type | Small organic molecule |
Emp. Form. | C22H24N2O4 |
Mol. Mass. | 380.437 |
SMILES | Cc1c(CC(N)=O)c2cc(OCCCC(O)=O)ccc2n1Cc1ccccc1 |
Structure |  |
n/a |
---|