Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFolate receptor alpha
LigandBDBM50059335
Substrate/Competitorn/a
Meas. Tech.ChEMBL_68374
Kd 0.0032±n/a nM
Citation Varney, MDPalmer, CLRomines, WHBoritzki, TMargosiak, SAAlmassy, RJanson, CABartlett, CHowland, EJFerre, R Protein structure-based design, synthesis, and biological evaluation of 5-thia-2,6-diamino-4(3H)-oxopyrimidines: potent inhibitors of glycinamide ribonucleotide transformylase with potent cell growth inhibition. J Med Chem40:2502-24 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Folate receptor alpha
Name:Folate receptor alpha
Synonyms:Adult folate-binding protein | FBP | FR-alpha | Folate receptor 1 | Folate receptor, adult | KB cells FBP | Ovarian tumor-associated antigen MOv18
Type:PROTEIN
Mol. Mass.:29827.41
Organism:Homo sapiens (Human)
Description:ChEMBL_1469596
Residue:257
Sequence:
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50059335
NameBDBM50059335
Synonyms:(S)-2-({5-[2-(2-Amino-4-oxo-4,6,7,8-tetrahydro-3H-pyrimido[5,4-b][1,4]thiazin-6-yl)-ethyl]-thiophene-2-carbonyl}-amino)-pentanedioic acid | CHEMBL84163
TypeSmall organic molecule
Emp. Form.C18H21N5O6S2
Mol. Mass.467.519
SMILESNc1nc2NCC(CCc3ccc(s3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)Sc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a