Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50059371
Substrate/Competitorn/a
Meas. Tech.ChEMBL_75462
IC50>10±n/a nM
Citation Bryant, SDGuerrini, RSalvadori, SBianchi, CTomatis, RAttila, MLazarus, LH Helix-inducing alpha-aminoisobutyric acid in opioid mimetic deltorphin C analogues. J Med Chem40:2579-87 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50059371
NameBDBM50059371
Synonyms:(S)-3-(2-{(R)-2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-propionylamino}-2-methyl-propionylamino)-N-{(S)-1-[(S)-1-(carbamoylmethyl-carbamoyl)-2-methyl-propylcarbamoyl]-2-methyl-propyl}-succinamic acid | CHEMBL315603
TypeSmall organic molecule
Emp. Form.C32H50N8O10
Mol. Mass.706.787
SMILESCC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)NCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a