Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 5-lipoxygenase
LigandBDBM50059611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157767
IC50>30000±n/a nM
Citation Müller, KPrinz, H Antipsoriatic anthrones with modulated redox properties. 4. Synthesis and biological activity of novel 9,10-dihydro-1,8-dihydroxy-9-oxo-2-anthracenecarboxylic and -hydroxamic acids. J Med Chem40:2780-7 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 5-lipoxygenase
Name:Arachidonate 5-lipoxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:49994.23
Organism:Bos taurus
Description:ChEMBL_157766
Residue:430
Sequence:
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGDIQLIKIEKRKYWFHDDWYLKYITVKTPCGDYIEFPCYRWISGEGEIVLRDGQAKLA
CDDQIHVLKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWSDFADFEKIFVRISNTISERVMNHWQEDRMFGYQFLNG
CNPVMIQRCLKLPDNLPVTTEMVECSLERQLTLEQEIEQGNIFIVDFKLLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQVPGEENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEYG
LFDKANATGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50059611
NameBDBM50059611
Synonyms:4-(1,8-Dihydroxy-9-oxo-9,10-dihydro-anthracene-2-carbonyl)-benzoic acid methyl ester | CHEMBL93818
TypeSmall organic molecule
Emp. Form.C23H16O6
Mol. Mass.388.3695
SMILESCOC(=O)c1ccc(cc1)C(=O)c1ccc2Cc3cccc(O)c3C(=O)c2c1O
Structure
n/a