Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM50060325
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48609
Ki>5000±n/a nM
Citation Martín-Martínez, MBartolomé-Nebreda, JMGómez-Monterrey, IGonzález-Muñiz, RGarcía-López, MTBallaz, SBarber, AFortuño, ADel Río, JHerranz, R Synthesis and stereochemical structure-activity relationships of 1,3-dioxoperhydropyrido[1,2-c]pyrimidine derivatives: potent and selective cholecystokinin-A receptor antagonists. J Med Chem40:3402-7 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CCKBR
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin A | Gastrin/cholecystokinin type B receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48980.43
Organism:RAT
Description:Cholecystokinin A CCKBR RAT::P30553
Residue:452
Sequence:
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL
ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV
QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW
RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA
RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060325
NameBDBM50060325
Synonyms:(2S,8S,8aR)-2-Benzyl-8-[(S)-2-tert-butoxycarbonylamino-3-(1H-indol-3-yl)-propionylamino]-3-oxo-octahydro-indolizine-2-carboxylic acid methyl ester | CHEMBL113699
TypeSmall organic molecule
Emp. Form.C33H40N4O6
Mol. Mass.588.6939
SMILESCOC(=O)[C@@]1(Cc2ccccc2)C[C@@H]2[C@H](CCCN2C1=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a