Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 2
LigandBDBM50060731
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143849
Ki>10000±n/a nM
Citation Hipskind, PALobb, KLNixon, JABritton, TCBruns, RFCatlow, JDieckman-McGinty, DKGackenheimer, SLGitter, BDIyengar, SSchober, DASimmons, RMSwanson, SZarrinmayeh, HZimmerman, DMGehlert, DR Potent and selective 1,2,3-trisubstituted indole NPY Y-1 antagonists. J Med Chem40:3712-4 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 2
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | NPY-Y2 receptor | NPY2-R | NPY2R | Neuropeptide Y receptor type 2 | Y2 receptor | neuropeptide Y receptor Y2
Type:Enzyme Catalytic Domain
Mol. Mass.:42734.65
Organism:Homo sapiens (Human)
Description:NPY-Y2 NPY2R HUMAN::P49146
Residue:381
Sequence:
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060731
NameBDBM50060731
Synonyms:2-(2,4-Dichloro-phenoxymethyl)-1-methyl-3-piperidin-1-ylmethyl-1H-indole | CHEMBL123410
TypeSmall organic molecule
Emp. Form.C22H24Cl2N2O
Mol. Mass.403.345
SMILESCn1c(COc2ccc(Cl)cc2Cl)c(CN2CCCCC2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a