Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic elastase
LigandBDBM50061024
Substrate/Competitorn/a
Meas. Tech.ChEMBL_152313
Ki 13±n/a nM
Citation Veale, CABernstein, PRBohnert, CMBrown, FJBryant, CDamewood, JREarley, RFeeney, SWEdwards, PDGomes, BHulsizer, JMKosmider, BJKrell, RDMoore, GSalcedo, TWShaw, ASilberstein, DSSteelman, GBStein, MStrimpler, AThomas, RMVacek, EPWilliams, JCWolanin, DJWoolson, S Orally active trifluoromethyl ketone inhibitors of human leukocyte elastase. J Med Chem40:3173-81 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic elastase
Name:Pancreatic elastase
Synonyms:Elastase 2A | Elastase-2 | Elastase-2A
Type:PROTEIN
Mol. Mass.:28705.23
Organism:Sus scrofa
Description:ChEMBL_156951
Residue:269
Sequence:
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061024
NameBDBM50061024
Synonyms:(2-Methyl-1-{(S)-oxo-[(S)-2-((S)-3,3,3-trifluoro-1-isopropyl-2-oxo-propylcarbamoyl)-pyrrolidin-1-yl]-methyl}-propyl)-carbamic acid methyl ester | CHEMBL79463 | {(S)-2-Methyl-1-[(S)-2-((S)-3,3,3-trifluoro-1-isopropyl-2-oxo-propylcarbamoyl)-pyrrolidine-1-carbonyl]-propyl}-carbamic acid methyl ester | {2-Methyl-1-[2-(3,3,3-trifluoro-1-isopropyl-2-oxo-propylcarbamoyl)-pyrrolidine-1-carbonyl]-propyl}-carbamic acid methyl ester(ZD8321)
TypeSmall organic molecule
Emp. Form.C18H28F3N3O5
Mol. Mass.423.4272
SMILESCOC(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a