Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase, Soat
LigandBDBM50063231
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28497
IC50 12±n/a nM
Citation Sliskovic, DRPicard, JAO'Brien, PMLiao, PRoark, WHRoth, BDAnderson, MAMueller, SBBocan, TMBousley, RFHamelehle, KLHoman, RReindel, JFStanfield, RLTurluck, DKrause, BR alpha-Substituted malonester amides: tools to define the relationship between ACAT inhibition and adrenal toxicity. J Med Chem41:682-90 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase, Soat
Name:Sterol O-acyltransferase, Soat
Synonyms:ACAT-1 | Cholesterol acyltransferase 1
Type:PROTEIN
Mol. Mass.:64165.56
Organism:Rattus norvegicus
Description:ChEMBL_28796
Residue:545
Sequence:
MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLF
LKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISR
RSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVI
WTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLA
YTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPT
LIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLC
VFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVH
DWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMA
FNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWT
CRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063231
NameBDBM50063231
Synonyms:CHEMBL159621 | N-(2,6-Diisopropyl-phenyl)-2-phenyl-malonamic acid 1,1-dimethyl-tridecyl ester
TypeSmall organic molecule
Emp. Form.C36H55NO3
Mol. Mass.549.8268
SMILESCCCCCCCCCCCCC(C)(C)OC(=O)C(C(=O)Nc1c(cccc1C(C)C)C(C)C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a