Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha adrenergic receptor 1A and 1B
LigandBDBM29568
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34640
Ki 0.2±n/a nM
Citation Patane, MAScott, ALBroten, TPChang, RSRansom, RWDiSalvo, JForray, CBock, MG 4-Amino-2-[4-[1-(benzyloxycarbonyl)-2(S)- [[(1,1-dimethylethyl)amino]carbonyl]-piperazinyl]-6, 7-dimethoxyquinazoline (L-765,314): a potent and selective alpha1b adrenergic receptor antagonist. J Med Chem41:1205-8 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha adrenergic receptor 1A and 1B
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1 Adrenergic Receptor | Alpha-1Adrenoceptor | Alpha-1B adrenergic receptor | Alpha-1B adrenoreceptor | adrenergic Alpha1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:56606.71
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortical membranes.
Residue:515
Sequence:
MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLP
SASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESP
GTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29568
NameBDBM29568
Synonyms:CHEMBL2 | PRAZOSIN | PRAZOSIN HYDROCHLORIDE | [3H]-Furazosin | [3H]-Minipress | [3H]-Pratsiol | [3H]-Prazosin
Typeradiolabeled ligand
Emp. Form.C19H21N5O4
Mol. Mass.383.4011
SMILESCOc1cc2nc(nc(N)c2cc1OC)N1CCN(CC1)C(=O)c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a