Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol dehydrogenase
LigandBDBM50064267
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31170
Ki 19000±n/a nM
Citation Schindler, JFBerst, KBPlapp, BV Inhibition of human alcohol dehydrogenases by formamides. J Med Chem41:1696-701 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alcohol dehydrogenase
Name:Alcohol dehydrogenase
Synonyms:Alcohol dehydrogenase gamma chain
Type:PROTEIN
Mol. Mass.:39877.25
Organism:Homo sapiens (Human)
Description:ChEMBL_31170
Residue:375
Sequence:
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
DLLRSGKSIRTVLTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064267
NameBDBM50064267
Synonyms:CHEMBL297125 | N,N-Dicyclobutyl-formamide
TypeSmall organic molecule
Emp. Form.C9H15NO
Mol. Mass.153.2215
SMILESO=CN(C1CCC1)C1CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a