Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-chymotrypsin
LigandBDBM50066333
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49753
Ki 67000±n/a nM
Citation Tucker, TJBrady, SFLumma, WCLewis, SDGardell, SJNaylor-Olsen, AMYan, YSisko, JTStauffer, KJLucas, BJLynch, JJCook, JJStranieri, MTHolahan, MALyle, EABaskin, EPChen, IWDancheck, KBKrueger, JACooper, CMVacca, JP Design and synthesis of a series of potent and orally bioavailable noncovalent thrombin inhibitors that utilize nonbasic groups in the P1 position. J Med Chem41:3210-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-chymotrypsin
Name:Alpha-chymotrypsin
Synonyms:Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin)
Type:Serine protease
Mol. Mass.:25670.88
Organism:Bos taurus (bovine)
Description:n/a
Residue:245
Sequence:
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50066333
NameBDBM50066333
Synonyms:(S)-1-((R)-2-Amino-2-cyclohexyl-acetyl)-pyrrolidine-2-carboxylic acid 5-chloro-2-cyclopropylcarbamoylmethoxy-benzylamide | CHEMBL108202
TypeSmall organic molecule
Emp. Form.C25H35ClN4O4
Mol. Mass.491.023
SMILESN[C@H](C1CCCCC1)C(=O)N1CCC[C@H]1C(=O)NCc1cc(Cl)ccc1OCC(=O)NC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a