Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50066906
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197392
EC50 620±n/a nM
Citation Benbrook, DMSubramanian, SGale, JBLiu, SBrown, CWBoehm, MFBerlin, KD Synthesis and characterization of heteroarotinoids demonstrate structure specificity relationships. J Med Chem41:3753-7 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoic acid receptor alpha/Retinoid X receptor alpha
Synonyms:Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | Retinoic acid receptor alpha
Type:PROTEIN
Mol. Mass.:50778.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1466191
Residue:462
Sequence:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50066906
NameBDBM50066906
Synonyms:4-[(E)-2-(4,4-Dimethyl-thiochroman-6-yl)-propenyl]-benzoic acid methyl ester | CHEMBL125587
TypeSmall organic molecule
Emp. Form.C22H24O2S
Mol. Mass.352.49
SMILESCOC(=O)c1ccc(\C=C(/C)c2ccc3SCCC(C)(C)c3c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a