Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50070172
Substrate/Competitorn/a
Meas. Tech.ChEBML_37377
IC50 260±n/a nM
Citation Parmee, EROk, HOCandelore, MRTota, LDeng, LStrader, CDWyvratt, MJFisher, MHWeber, AE Discovery of L-755,507: a subnanomolar human beta 3 adrenergic receptor agonist. Bioorg Med Chem Lett8:1107-12 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070172
NameBDBM50070172
Synonyms:4-(3-Cyclohexyl-ureido)-N-(4-{2-[(S)-2-hydroxy-3-(4-hydroxy-phenoxy)-propylamino]-ethyl}-phenyl)-benzenesulfonamide | CHEMBL13432
TypeSmall organic molecule
Emp. Form.C30H38N4O6S
Mol. Mass.582.711
SMILESO[C@@H](CNCCc1ccc(NS(=O)(=O)c2ccc(NC(=O)NC3CCCCC3)cc2)cc1)COc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a