Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50070641
Substrate/Competitorn/a
Meas. Tech.ChEBML_30791
Ki 0.510000±n/a nM
Citation Curtis, MAVarkhedkar, VPragnacharyulu, PVAbushanab, E Adenosine deaminase inhibitors. Synthesis and biological evaluation of aralkyladenines (ARADS). Bioorg Med Chem Lett8:1639-42 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070641
NameBDBM50070641
Synonyms:(2S,3R)-3-(6-Amino-purin-9-yl)-6-o-tolyl-hexan-2-ol | 3-(6-Amino-purin-9-yl)-6-o-tolyl-hexan-2-ol | CHEMBL42063
TypeSmall organic molecule
Emp. Form.C18H23N5O
Mol. Mass.325.4081
SMILESC[C@H](O)[C@@H](CCCc1ccccc1C)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a