Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGluR4)
LigandBDBM50072177
Substrate/Competitorn/a
Meas. Tech.ChEBML_104633
IC50 10080±n/a nM
Citation Collado, IEzquerra, JMazón, APedregal, CYruretagoyena, BKingston, AETomlinson, RWright, RAJohnson, BGSchoepp, DD 2,3'-disubstituted-2-(2'-carboxycyclopropyl)glycines as potent and selective antagonists of metabotropic glutamate receptors. Bioorg Med Chem Lett8:2849-54 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4 (mGluR4)
Name:Metabotropic glutamate receptor 4
Synonyms:GRM4 | Glutamate receptor, metabotropic 4 | Metabotropic glutamate receptor 4 | mGluR4 | metabotropic glutamate 4
Type:Protein
Mol. Mass.:101899.95
Organism:Homo sapiens (Human)
Description:Q14833
Residue:912
Sequence:
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072177
NameBDBM50072177
Synonyms:(1S,2S,3S)-2-[1-Amino-1-carboxy-2-(9H-xanthen-9-yl)-ethyl]-3-butyl-cyclopropanecarboxylic acid | CHEMBL95868
TypeSmall organic molecule
Emp. Form.C24H27NO5
Mol. Mass.409.4749
SMILESCCCC[C@@H]1[C@@H]([C@H]1C(N)(CC1c2ccccc2Oc2ccccc12)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a