Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50074297
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196913
Ki 11±n/a nM
Citation Canan Koch, SSDardashti, LJCesario, RMCroston, GEBoehm, MFHeyman, RANadzan, AM Synthesis of retinoid X receptor-specific ligands that are potent inducers of adipogenesis in 3T3-L1 cells. J Med Chem42:742-50 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074297
NameBDBM50074297
Synonyms:4-[[(E)-Cyanomethoxyimino]-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-methyl]-benzoic acid | CHEMBL164902
TypeSmall organic molecule
Emp. Form.C25H28N2O3
Mol. Mass.404.5014
SMILESCc1cc2c(cc1\C(=N\OCC#N)c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a