Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-chymotrypsin
LigandBDBM50075106
Substrate/Competitorn/a
Meas. Tech.ChEMBL_216469
IC50 18±n/a nM
Citation Iijima, KKatada, JHayashi, Y Symmetrical anhydride-type serine protease inhibitors: structure-activity relationship studies of human chymase inhibitors. Bioorg Med Chem Lett9:413-8 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-chymotrypsin
Name:Beta-chymotrypsin
Synonyms:CTRB1 | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB
Type:PROTEIN
Mol. Mass.:27713.98
Organism:Homo sapiens (Human)
Description:ChEMBL_10909
Residue:263
Sequence:
MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075106
NameBDBM50075106
Synonyms:1,1-dimethyl-4-phenyl-2-phenylcarboxamidopentanoic anhydride | CHEMBL134821
TypeSmall organic molecule
Emp. Form.C40H44N2O5
Mol. Mass.632.7878
SMILESCC(C)(C(CCc1ccccc1)NC(=O)c1ccccc1)C(=O)OC(=O)C(C)(C)C(CCc1ccccc1)NC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a