Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-galactosidase
LigandBDBM50075942
Substrate/Competitorn/a
Meas. Tech.ChEMBL_215886
Ki 7500±n/a nM
Citation Pasquarello, CDemange, RVogel, P Synthesis of alpha-C(1-->3)-mannopyranoside of N-acetylgalactosamine, a new beta-galactosidase inhibitor. Bioorg Med Chem Lett9:793-6 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-galactosidase
Name:Beta-galactosidase
Synonyms:Acid beta-galactosidase | Elastin receptor 1 | Lactase
Type:PROTEIN
Mol. Mass.:76074.43
Organism:Homo sapiens
Description:ChEMBL_215886
Residue:677
Sequence:
MPGFLVRILPLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPV
ITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
DFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKV
PEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWA
HNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
LMPPPPQKNKDSWLDHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075942
NameBDBM50075942
Synonyms:CHEMBL165192 | N-[2,5-Dihydroxy-6-hydroxymethyl-4-(3,4,5-trihydroxy-6-hydroxymethyl-tetrahydro-pyran-2-ylmethyl)-tetrahydro-pyran-3-yl]-acetamide and N-[5-(1,2-Dihydroxy-ethyl)-2-hydroxy-4-(3,4,5-trihydroxy-6-hydroxymethyl-tetrahydro-pyran-2-ylmethyl)-tetrahydro-furan-3-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C15H27NO10
Mol. Mass.381.3756
SMILESCC(=O)N[C@H]1C(O)O[C@H](C(O)CO)[C@@H]1C[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a