Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 Receptor
LigandBDBM50078656
Substrate/Competitorn/a
Meas. Tech.ChEMBL_211252
IC50 1±n/a nM
Citation Aranapakam, VAlbright, JDGrosu, GTDelos Santos, EGChan, PSCoupet, JRu, XSaunders, TMazandarani, H 5-fluoro-2-methyl-N-[5-(5H-pyrrolo[2,1-c][1,4]benzodiazepine-10(11H)-yl carbonyl)-2-pyridinyl]benzamide (CL-385004) and analogs as orally active arginine vasopressin receptor antagonists. Bioorg Med Chem Lett9:1737-40 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 Receptor
Name:Vasopressin receptor
Synonyms:AVPR V2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2
Type:G-protein coupled receptor
Mol. Mass.:40761.85
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:371
Sequence:
MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG
ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ
RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP
SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA
PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT
ASSSLMKDTPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078656
n/a
NameBDBM50078656
Synonyms:CHEMBL46295 | N-[5-(5H,11H-Benzo[e]pyrrolo[1,2-a][1,4]diazepine-10-carbonyl)-pyridin-2-yl]-3-fluoro-2-methyl-benzamide
TypeSmall organic molecule
Emp. Form.C26H21FN4O2
Mol. Mass.440.4689
SMILESCc1c(F)cccc1C(=O)Nc1ccc(cn1)C(=O)N1Cc2cccn2Cc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: