Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 1
LigandBDBM7585
Substrate/Competitorn/a
Meas. Tech.ChEMBL_50351
IC50 650±n/a nM
Citation Schultz, CLink, ALeost, MZaharevitz, DWGussio, RSausville, EAMeijer, LKunick, C Paullones, a series of cyclin-dependent kinase inhibitors: synthesis, evaluation of CDK1/cyclin B inhibition, and in vitro antitumor activity. J Med Chem42:2909-19 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 1
Name:Cyclin-dependent kinase 1/G1/S-specific cyclin-D1
Synonyms:Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | p34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:34101.08
Organism:Homo sapiens (human)
Description:P06493
Residue:297
Sequence:
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7585
NameBDBM7585
Synonyms:(R,S)-Roscovitine | 2,6,9-Trisubstituted purine deriv. 27 | 2-{[6-(benzylamino)-9-(propan-2-yl)-9H-purin-2-yl]amino}butan-1-ol | CHEMBL52387
TypeSmall organic molecule
Emp. Form.C19H26N6O
Mol. Mass.354.4493
SMILESCCC(CO)Nc1nc(NCc2ccccc2)c2ncn(C(C)C)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM7585
Synonyms:(R,S)-Roscovitine | 2,6,9-Trisubstituted purine deriv. 27 | 2-{[6-(benzylamino)-9-(propan-2-yl)-9H-purin-2-yl]amino}butan-1-ol | CHEMBL52387
TypeSmall organic molecule
Emp. Form.C19H26N6O
Mol. Mass.354.4493
SMILESCCC(CO)Nc1nc(NCc2ccccc2)c2ncn(C(C)C)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: