Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50081150
Substrate/Competitorn/a
Meas. Tech.ChEBML_71726
IC50 15±n/a nM
Citation DeVita, RJGoulet, MTWyvratt, MJFisher, MHLo, JLYang, YTCheng, KSmith, RG Investigation of the 4-O-alkylamine substituent of non-peptide quinolone GnRH receptor antagonists. Bioorg Med Chem Lett9:2621-4 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081150
NameBDBM50081150
Synonyms:7-Chloro-3-(3,5-dimethyl-phenyl)-6-nitro-4-((S)-2-pyrrolidin-2-yl-ethoxy)-1H-quinolin-2-one | CHEMBL313501 | CHEMBL328063
TypeSmall organic molecule
Emp. Form.C23H24ClN3O4
Mol. Mass.441.907
SMILESCc1cc(C)cc(c1)-c1c(OCCC2CCCN2)c2cc(c(Cl)cc2[n-]c1=[OH+])[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a