Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric-oxide synthase, endothelial
LigandBDBM50081592
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144494
IC50 300000±n/a nM
Citation Fröhlich, LGKotsonis, PTraub, HTaghavi-Moghadam, SAl-Masoudi, NHofmann, HStrobel, HMatter, HPfleiderer, WSchmidt, HH Inhibition of neuronal nitric oxide synthase by 4-amino pteridine derivatives: structure-activity relationship of antagonists of (6R)-5,6,7,8-tetrahydrobiopterin cofactor. J Med Chem42:4108-21 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric-oxide synthase, endothelial
Name:Nitric-oxide synthase, endothelial
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:133411.76
Organism:Sus scrofa
Description:ChEMBL_144495
Residue:1205
Sequence:
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPAPATPHAPEHSPAPNSPT
LTRPPEGPKFPRVKNWEVGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRKLQSRPSPGPP
PAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVATTGTYHLGESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRTPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
PPELFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIV
DHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPD
PWKGSAAKGTGIARKKTFKEVANAVKISASLMATVMPKRVKASILYASETVRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
GSPRPEQHRSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKA
AARDIFSPKRSWKRQRYRLSAQVEGLQLLPGLVHVHRRKMFQATVLSVENLQSSKSTRAT
ILVRLDTEGQEGLQYQPGDHIGICPPNRTGLVEALLSRVEDPTPPTESVGVEQLEKGSPG
GPPPSWVRDPRLPPYTLRQALTFFLDITSPPSPRLLRVLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPTPLLLTQLALLQPRYYSVSSAPSTYPGEIHPTVA
VLAYRTQDGLGPLHYGVCSTWLGQLKPGDPVPCFIRAAPSFRLPPDPSLPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGNME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWTFDPPGP
DTPGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081592
NameBDBM50081592
Synonyms:2,4-Diamino-7,8-dihydro-6H-pteridine-5-carbaldehyde | CHEMBL328636
TypeSmall organic molecule
Emp. Form.C7H10N6O
Mol. Mass.194.1939
SMILESNc1nc(N)c2N(CCNc2n1)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a