Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1D adrenergic receptor
LigandBDBM50082810
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32452
Ki 260±n/a nM
Citation Murali Dhar, TGNagarathnam, DMarzabadi, MRLagu, BWong, WCChiu, GTyagarajan, SMiao, SWZhang, FSun, WTian, DShen, QZhang, JWetzel, JMForray, CChang, RSBroten, TPSchorn, TWChen, TBO'Malley, SRansom, RSchneck, KBendesky, RHarrell, CMVyas, KP Design and synthesis of novel alpha(1)(a) adrenoceptor-selective antagonists. 2. Approaches to eliminate opioid agonist metabolites via modification of linker and 4-methoxycarbonyl-4-phenylpiperidine moiety. J Med Chem42:4778-93 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1D adrenergic receptor
Name:Alpha adrenergic receptor (1a and 1d)
Synonyms:ADRA1A | ADRA1D | Adrenergic receptor alpha | Alpha 1D-adrenoceptor | Alpha 1D-adrenoreceptor | Alpha-1D adrenoceptor | Alpha-adrenergic receptor 1a | adrenergic Alpha1D
Type:Enzyme Catalytic Domain
Mol. Mass.:60485.82
Organism:Homo sapiens (Human)
Description:adrenergic Alpha1D ADRA1D HUMAN::P25100
Residue:572
Sequence:
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50082810
NameBDBM50082810
Synonyms:3-[3-(4-Cyano-4-phenyl-piperidin-1-yl)-propylcarbamoyl]-4-(3,4-difluoro-phenyl)-6-methoxymethyl-2-oxo-1,2,3,4-tetrahydro-pyrimidine-5-carboxylic acid methyl ester | CHEMBL142929
TypeSmall organic molecule
Emp. Form.C30H33F2N5O5
Mol. Mass.581.6103
SMILESCOCC1=C(C(N(C(=O)NCCCN2CCC(CC2)(C#N)c2ccccc2)C(=O)N1)c1ccc(F)c(F)c1)C(=O)OC |t:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a