Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50084019
Substrate/Competitorn/a
Meas. Tech.ChEBML_31409
Ki 1300±n/a nM
Citation Webb, TRMelman, NLvovskiy, DJi, XDJacobson, KA The utilization of a unified pharmacophore query in the discovery of new antagonists of the adenosine receptor family. Bioorg Med Chem Lett10:31-4 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084019
NameBDBM50084019
Synonyms:6,7-Dimethoxy-3-[4-(4-methoxy-phenyl)-thiazol-2-ylamino]-3H-isobenzofuran-1-one | CHEMBL114643
TypeSmall organic molecule
Emp. Form.C20H18N2O5S
Mol. Mass.398.432
SMILESCOc1ccc(cc1)-c1csc(NC2OC(=O)c3c2ccc(OC)c3OC)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a