Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50061625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197400
IC50 78±n/a nM
Citation Kikuchi, KHibi, SYoshimura, HTokuhara, NTai, KHida, TYamauchi, TNagai, M Syntheses and structure-activity relationships of 5,6,7, 8-tetrahydro-5,5,8,8-tetramethyl-2-quinoxaline derivatives with retinoic acid receptor alpha agonistic activity. J Med Chem43:409-19 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoic acid receptor alpha/Retinoid X receptor alpha
Synonyms:Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | Retinoic acid receptor alpha
Type:PROTEIN
Mol. Mass.:50778.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1466191
Residue:462
Sequence:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061625
NameBDBM50061625
Synonyms:4-[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbamoyl]benzoic acid | Am 80 | CHEMBL25202 | Tamibarotene | US9963439, AM80 | retinobenzoic acid
TypeSmall organic molecule
Emp. Form.C22H25NO3
Mol. Mass.351.4388
SMILESCC1(C)CCC(C)(C)c2cc(NC(=O)c3ccc(cc3)C(O)=O)ccc12
Structure
n/a