Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA1B
LigandBDBM50087490
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34312
Ki 3.73±n/a nM
Citation Meyer, MDAltenbach, RJBasha, FZCarroll, WACondon, SElmore, SWKerwin, JFSippy, KBTietje, KWendt, MDHancock, AABrune, MEBuckner, SADrizin, I Structure-activity studies for a novel series of tricyclic substituted hexahydrobenz[e]isoindole alpha(1A) adrenoceptor antagonists as potential agents for the symptomatic treatment of benign prostatic hyperplasia (BPH). J Med Chem43:1586-603 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADRA1B
Name:ADRA1B
Synonyms:Adrenergic receptor alpha | Alpha-1b adrenergic receptor | adrenergic Alpha1B
Type:Enzyme Catalytic Domain
Mol. Mass.:56514.13
Organism:C.H.O.
Description:adrenergic Alpha1B ADRA1B C.H.O.::P18841
Residue:515
Sequence:
MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLP
SASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESP
GTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087490
NameBDBM50087490
Synonyms:3-Methoxy-7-[2-(6-methoxy-1,3,3a,4,5,9b-hexahydro-benzo[e]isoindol-2-yl)-ethyl]-5H-9-thia-1,4,5,7-tetraaza-fluorene-6,8-dione | CHEMBL441032
TypeSmall organic molecule
Emp. Form.C24H25N5O4S
Mol. Mass.479.551
SMILESCOc1cnc2sc3c([nH]c(=O)n(CCN4C[C@@H]5CCc6c(OC)cccc6[C@@H]5C4)c3=O)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a